PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.003G222900.1
Common NamePHAVU_003G222900g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB_related
Protein Properties Length: 334aa    MW: 35958.9 Da    PI: 7.1414
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.003G222900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.42.8e-1299143347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT+eE+  ++ + ++lG+g+W+ Iar     Rt+ q+ s+ qky
  Phvul.003G222900.1  99 PWTEEEHRMFLLGLQKLGKGDWRGIARNYVISRTPTQVASHAQKY 143
                         8*****************************89************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.93992148IPR017930Myb domain
SuperFamilySSF466897.9E-1794149IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-1995147IPR006447Myb domain, plants
SMARTSM007178.0E-1196146IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-1196142IPR009057Homeodomain-like
PfamPF002491.1E-1099143IPR001005SANT/Myb domain
CDDcd001672.59E-999144No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000122Biological Processnegative regulation of transcription from RNA polymerase II promoter
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0030307Biological Processpositive regulation of cell growth
GO:0046686Biological Processresponse to cadmium ion
GO:0048366Biological Processleaf development
GO:2000469Biological Processnegative regulation of peroxidase activity
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MTRRCSHCSH NGHNSRTCPN RGVKLFGVRL TDGSIRKSAS MGNLTHYAGS GSGPLHVGSN  60
NPGSPGETPD HVTAADGYAS EDFVPGSSSS SRERKKGVPW TEEEHRMFLL GLQKLGKGDW  120
RGIARNYVIS RTPTQVASHA QKYFIRQSNV SRRKRRSSLF DIVADEGADT PMVQQDFLSA  180
NQLPVETEGN NPLPAPPPLD EECESMDSTN SNDGDPAPSK PENTQSSYPV LYPAYYSPVF  240
PFPLPYWSGY SPEPIKKETH EVLKPTAVHS KSPINVDELV GISKLSLGES IGDAGPSSLS  300
LKLLEEGPSR QSAFHATPTC GSSNMNGSAI HAV*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00551DAPTransfer from AT5G47390Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0312730.0KT031273.1 Glycine max clone HN_CCL_95 MYB/HD-like transcription factor (Glyma17g15330.1_like2) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007155690.10.0hypothetical protein PHAVU_003G222900g
SwissprotQ2V9B04e-37MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLV7CC320.0V7CC32_PHAVU; Uncharacterized protein
STRINGGLYMA17G15330.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF72303145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.11e-145MYB_related family protein